PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06879g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 733aa    MW: 80919.1 Da    PI: 8.4146
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06879g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094414781954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf06879g00001.1 441 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 478
                               554459******************************88 PP

2BELL119.71.3e-38302373172
                      BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               +rqelq+kkakL+s+l+eV++rY+qy++q+q++++sFe++ag+gsak+Yt+lAl++iS++FrcLkdai++qi
  Niben101Scf06879g00001.1 302 QRQELQMKKAKLISMLDEVEQRYRQYHHQMQIIVASFEEAAGIGSAKSYTQLALHTISKQFRCLKDAITGQI 373
                               69*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-55223371IPR006563POX domain
PfamPF075269.5E-47230370IPR006563POX domain
PROSITE profilePS5007112.05419482IPR001356Homeobox domain
SMARTSM003894.2E-10422486IPR001356Homeobox domain
CDDcd000868.11E-12422483No hitNo description
SuperFamilySSF466895.56E-17423489IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29425488IPR009057Homeodomain-like
PfamPF059202.9E-18439478IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MAMYYQGSSE IQADGLQTLY LMNPNYIGYT DTPHQQQQQQ QNLEQANMFF LNSGTAGNLP  60
HGQLPSQAHT QHLVGVPLQT SFQDPSRPSV HEVSTSHHGL LQRLWISNGR NSGGSGGNES  120
QSHIPSAVVS PNSGGGTTTD FASQLGFQRP GLVSPTQQHQ GLSLSLSPQQ QQQQQQMINF  180
RSFPLDHHEI SPHNNHQVGI LSSPSQRTNT NNDHIRGSGA SSSSFSNGMI VGSKYLKAAQ  240
QLLDEVVTVG KNIKEIGAKE KDRLLDNELM PLNSDVAASA PTSGSGGSGS QKNSVAELTT  300
VQRQELQMKK AKLISMLDEV EQRYRQYHHQ MQIIVASFEE AAGIGSAKSY TQLALHTISK  360
QFRCLKDAIT GQIKATSKSL GEEEINLGGK IEGSSSRLRF VDHHLRQQRA LQQLGMMQPN  420
AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKIMLAKQ TGLTRSQVSN WFINARVRLW  480
KPMVEEMYLE EVKNNQAQQN GLEENANKND KPNEEMSTKP SAPHETTNLR KDKQISSILQ  540
DASPTEISSS TISTSPTAGS LPAQAAGFSF IGSLNMENST SERNNKKPRN DMQNSSSSIL  600
SMETAMKAGD TRKGEKFNGD NRQARDRSYP LMTAYSTMGE FGRFNPEQQL AASFQGNGVS  660
LTLGLPPSEN LVLSGSQHNF LPNQNIGIEM GRIESHYNRM SNPQPSHPNI TYENIDFQSG  720
KRYAAQLLPD FVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B4e-16428486563Homeobox protein Meis2
3k2a_A4e-16428486563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778871.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778870.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778869.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478052.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478051.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478049.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLM1BQG30.0M1BQG3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000505270.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-102BEL1-like homeodomain 1